Lineage for d2croa_ (2cro A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2709316Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 2709317Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 2709338Family a.35.1.2: Phage repressors [47419] (7 proteins)
    consists of different sequence families of HTH repressors of phage origins
  6. 2709352Protein cro 434 [47424] (1 species)
  7. 2709353Species Bacteriophage 434 [TaxId:10712] [47425] (3 PDB entries)
    contains a short additional helix at C-terminus
  8. 2709354Domain d2croa_: 2cro A: [17038]

Details for d2croa_

PDB Entry: 2cro (more details), 2.35 Å

PDB Description: structure of phage 434 cro protein at 2.35 angstroms resolution
PDB Compounds: (A:) regulatory protein cro

SCOPe Domain Sequences for d2croa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2croa_ a.35.1.2 (A:) cro 434 {Bacteriophage 434 [TaxId: 10712]}
mqtlserlkkrrialkmtqtelatkagvkqqsiqlieagvtkrprflfeiamalncdpvw
lqygt

SCOPe Domain Coordinates for d2croa_:

Click to download the PDB-style file with coordinates for d2croa_.
(The format of our PDB-style files is described here.)

Timeline for d2croa_: