Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
Protein automated matches [190075] (16 species) not a true protein |
Species Aspergillus fumigatus [TaxId:451804] [189778] (2 PDB entries) |
Domain d2xtka_: 2xtk A: [170379] automated match to d1hvqa_ complexed with azm, po4 |
PDB Entry: 2xtk (more details), 2 Å
SCOPe Domain Sequences for d2xtka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xtka_ c.1.8.0 (A:) automated matches {Aspergillus fumigatus [TaxId: 451804]} fsnlaiywgqgpnqlrlshfcqetsldiinigfinyfpdmspghwpgsnfgnqcdgsvyv tndgvvtkllsgchqimedipicqaagkkvllsiggayppdqsilsedsavafatflwga fgpvaegwegprpfgdvvvdgfdfdiehnggfgyatmvntfrqyfnqvperkfylsaapq ciipdaqlsdaifnaafdfiwiqyyntaacsaksfidtslgtfnfdawvtvlkasaskda klyvglpasetaanqgyyltpdeveslvstymdrypdtfggimlweatasennqidgapy adhmkdillh
Timeline for d2xtka_: