Lineage for d2xt1b1 (2xt1 B:0-112)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2023921Protein automated matches [190119] (22 species)
    not a true protein
  7. 2025070Species Vicugna pacos [TaxId:30538] [189756] (35 PDB entries)
  8. 2025071Domain d2xt1b1: 2xt1 B:0-112 [170378]
    Other proteins in same PDB: d2xt1a_, d2xt1b2
    automated match to d2p42b1
    complexed with gol

Details for d2xt1b1

PDB Entry: 2xt1 (more details), 1.32 Å

PDB Description: crystal structure of the hiv-1 capsid protein c-terminal domain (146- 231) in complex with a camelid vhh.
PDB Compounds: (B:) camelid vhh 9

SCOPe Domain Sequences for d2xt1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xt1b1 b.1.1.1 (B:0-112) automated matches {Vicugna pacos [TaxId: 30538]}
aqvqlvesggglvqaggslrlscaasgsffmsnvmawyrqapgkareliaairggdmstv
yddsvkgrftitrdddknilylqmndlkpedtamyyckasgsswgqgtqvtvs

SCOPe Domain Coordinates for d2xt1b1:

Click to download the PDB-style file with coordinates for d2xt1b1.
(The format of our PDB-style files is described here.)

Timeline for d2xt1b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2xt1b2
View in 3D
Domains from other chains:
(mouse over for more information)
d2xt1a_