Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (22 species) not a true protein |
Species Vicugna pacos [TaxId:30538] [189756] (35 PDB entries) |
Domain d2xt1b1: 2xt1 B:0-112 [170378] Other proteins in same PDB: d2xt1a_, d2xt1b2 automated match to d2p42b1 complexed with gol |
PDB Entry: 2xt1 (more details), 1.32 Å
SCOPe Domain Sequences for d2xt1b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xt1b1 b.1.1.1 (B:0-112) automated matches {Vicugna pacos [TaxId: 30538]} aqvqlvesggglvqaggslrlscaasgsffmsnvmawyrqapgkareliaairggdmstv yddsvkgrftitrdddknilylqmndlkpedtamyyckasgsswgqgtqvtvs
Timeline for d2xt1b1: