SCOPe 2.01: Domain d2xsta_: 2xst A:

Lineage for d2xsta_ (2xst A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.0: automated matches [191454] (1 protein)
   not a true family

6. Protein automated matches [190698] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187833] (4 PDB entries)

8. Domain d2xsta_: 2xst A: [170377]
   automated match to d1jzua_
   complexed with edo

Details for d2xsta_

PDB Entry: 2xst, 1.63 Å

PDB Description: crystal structure of the human lipocalin 15

PDB Compounds: (A:) lipocalin 15

SCOPe Domain Sequences for d2xsta_:

Sequence, based on SEQRES records:

>d2xsta_ b.60.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aevllqpdfnaekfsglwyvvsmasdcrvflgkkdhlsmstrairpteegglhvhmefpg
adgcnqvdaeylkvgseghfrvpalgyldvrivdtdyssfavlyiykelegalstmvqly
srtqdvspqalksfqdfyptlglpkdmmvmlpqs

Sequence, based on observed residues (ATOM records):

>d2xsta_ b.60.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aevllqpdfnaekfsglwyvvsmasdcrvflgkkdhlsmstrairpteegglhvhmefpn
qvdaeylkvgseghfrvpalgyldvrivdtdyssfavlyiykelegalstmvqlysrtqd
vspqalksfqdfyptlglpkdmmvmlpqs

Timeline for d2xsta_:

• d2xsta_ is new in SCOPe 2.01-stable
  
• d2xsta_ appears in SCOPe 2.02
  
• d2xsta_ appears in the current release, SCOPe 2.08