Lineage for d2xspa_ (2xsp A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2779928Family b.29.1.10: Glycosyl hydrolase family 7 catalytic core [49971] (2 proteins)
    contains many insertions in the common fold
    automatically mapped to Pfam PF00840
  6. 2779993Protein automated matches [190170] (17 species)
    not a true protein
  7. 2780012Species Heterobasidion annosum [TaxId:13563] [189755] (2 PDB entries)
  8. 2780013Domain d2xspa_: 2xsp A: [170376]
    automated match to d1gpia_
    complexed with epe, mg, xys

Details for d2xspa_

PDB Entry: 2xsp (more details), 1.7 Å

PDB Description: structure of cellobiohydrolase 1 (cel7a) from heterobasidion annosum
PDB Compounds: (A:) Cellulose 1,4-beta-cellobiosidase

SCOPe Domain Sequences for d2xspa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xspa_ b.29.1.10 (A:) automated matches {Heterobasidion annosum [TaxId: 13563]}
eqvgtqtaenhpkltvsqcsaggscttesrsvvldsnwrwlhttsgttncytgntwdasl
cpdpvtcaqncaldgadysgtygistsgnaltlkfvtngpystnigsrvylmsaddtnye
ifklknqefafdvdmsnlpcglngalyfvemdadgglsrfpnnkagskygtgycdtqcpq
dikfingeanilgwtpsssdsnagtgqygsccnemdvweaninsaavtphvcnvqgqtrc
sgtqcgdgderydgicdkdgcdfnsfrmgnqtflgpgktvntnskftvvtqfltsdnttt
gtlheirrlyvqngkviansktniagmsqfdsitddfcnaqktafgdtnsfenlgglnvm
gqafdkgvvlvmsvwddheanmlwldsdypttssastpgvargtcattsgvpanvesqnp
nssvvfsnikigpigstyta

SCOPe Domain Coordinates for d2xspa_:

Click to download the PDB-style file with coordinates for d2xspa_.
(The format of our PDB-style files is described here.)

Timeline for d2xspa_: