Lineage for d2xsox_ (2xso X:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542783Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2543372Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2543693Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins)
    Pfam PF00866
  6. 2543749Protein automated matches [190223] (5 species)
    not a true protein
  7. 2543750Species Burkholderia xenovorans [TaxId:266265] [189543] (9 PDB entries)
  8. 2543780Domain d2xsox_: 2xso X: [170375]
    Other proteins in same PDB: d2xsoa1, d2xsoa2, d2xsoc1, d2xsoc2, d2xsoe1, d2xsoe2, d2xsog1, d2xsog2, d2xsoi1, d2xsoi2, d2xsok1, d2xsok2, d2xsom1, d2xsom2, d2xsoo1, d2xsoo2, d2xsoq1, d2xsoq2, d2xsos1, d2xsos2, d2xsou1, d2xsou2, d2xsow1, d2xsow2
    automated match to d1wqlb1
    complexed with fe2, fes

Details for d2xsox_

PDB Entry: 2xso (more details), 2.2 Å

PDB Description: crystal structure of p4 variant of biphenyl dioxygenase from burkholderia xenovorans lb400
PDB Compounds: (X:) Biphenyl dioxygenase subunit beta

SCOPe Domain Sequences for d2xsox_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xsox_ d.17.4.4 (X:) automated matches {Burkholderia xenovorans [TaxId: 266265]}
ffktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmplrtnrmir
egeleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivketatpdt
fevnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastllsnnlsmf
f

SCOPe Domain Coordinates for d2xsox_:

Click to download the PDB-style file with coordinates for d2xsox_.
(The format of our PDB-style files is described here.)

Timeline for d2xsox_: