Lineage for d2xsor_ (2xso R:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1404616Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1405093Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1405348Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins)
    Pfam PF00866
  6. 1405407Protein automated matches [190223] (3 species)
    not a true protein
  7. 1405408Species Burkholderia xenovorans [TaxId:266265] [189543] (7 PDB entries)
  8. 1405435Domain d2xsor_: 2xso R: [170372]
    automated match to d1wqlb1
    complexed with fe2, fes

Details for d2xsor_

PDB Entry: 2xso (more details), 2.2 Å

PDB Description: crystal structure of p4 variant of biphenyl dioxygenase from burkholderia xenovorans lb400
PDB Compounds: (R:) Biphenyl dioxygenase subunit beta

SCOPe Domain Sequences for d2xsor_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xsor_ d.17.4.4 (R:) automated matches {Burkholderia xenovorans [TaxId: 266265]}
ffktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmplrtnrmir
egeleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivketatpdt
fevnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastllsnnlsmf
f

SCOPe Domain Coordinates for d2xsor_:

Click to download the PDB-style file with coordinates for d2xsor_.
(The format of our PDB-style files is described here.)

Timeline for d2xsor_: