SCOPe 2.06: Domain d1praa_: 1pra A:

Lineage for d1praa_ (1pra A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.2: Phage repressors [47419] (7 proteins)
   consists of different sequence families of HTH repressors of phage origins

6. Protein 434 C1 repressor, DNA-binding domain [47422] (1 species)

7. Species Bacteriophage 434 [TaxId:10712] [47423] (8 PDB entries)
   Uniprot P16117 10-62; contains a short additional helix at C-terminus

8. Domain d1praa_: 1pra A: [17037]

Details for d1praa_

PDB Entry: 1pra

PDB Description: determination of the nuclear magnetic resonance solution structure of the dna-binding domain (residues 1 to 69) of the 434 repressor and comparison with the x-ray crystal structure

PDB Compounds: (A:) 434 repressor

SCOPe Domain Sequences for d1praa_:

Sequence; same for both SEQRES and ATOM records:

>d1praa_ a.35.1.2 (A:) 434 C1 repressor, DNA-binding domain {Bacteriophage 434 [TaxId: 10712]}
sissrvkskriqlglnqaelaqkvgttqqsieqlengktkrprflpelasalgvsvdwll
ngtsdsnvr

Timeline for d1praa_:

• d1praa_ first appeared (with stable ids) in SCOP 1.55, called d1pra__
  
• d1praa_ appears in SCOPe 2.05
  
• d1praa_ appears in SCOPe 2.07
  
• d1praa_ appears in the current release, SCOPe 2.08