Lineage for d1praa_ (1pra A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2709316Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 2709317Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 2709338Family a.35.1.2: Phage repressors [47419] (7 proteins)
    consists of different sequence families of HTH repressors of phage origins
  6. 2709339Protein 434 C1 repressor, DNA-binding domain [47422] (1 species)
  7. 2709340Species Bacteriophage 434 [TaxId:10712] [47423] (8 PDB entries)
    Uniprot P16117 10-62; contains a short additional helix at C-terminus
  8. 2709349Domain d1praa_: 1pra A: [17037]

Details for d1praa_

PDB Entry: 1pra (more details)

PDB Description: determination of the nuclear magnetic resonance solution structure of the dna-binding domain (residues 1 to 69) of the 434 repressor and comparison with the x-ray crystal structure
PDB Compounds: (A:) 434 repressor

SCOPe Domain Sequences for d1praa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1praa_ a.35.1.2 (A:) 434 C1 repressor, DNA-binding domain {Bacteriophage 434 [TaxId: 10712]}
sissrvkskriqlglnqaelaqkvgttqqsieqlengktkrprflpelasalgvsvdwll
ngtsdsnvr

SCOPe Domain Coordinates for d1praa_:

Click to download the PDB-style file with coordinates for d1praa_.
(The format of our PDB-style files is described here.)

Timeline for d1praa_: