SCOPe 2.08: Domain d2xsob_: 2xso B:

Lineage for d2xsob_ (2xso B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins)
   Pfam PF00866

6. Protein automated matches [190223] (5 species)
   not a true protein

7. Species Burkholderia xenovorans [TaxId:266265] [189543] (9 PDB entries)

8. Domain d2xsob_: 2xso B: [170364]
   Other proteins in same PDB: d2xsoa1, d2xsoa2, d2xsoc1, d2xsoc2, d2xsoe1, d2xsoe2, d2xsog1, d2xsog2, d2xsoi1, d2xsoi2, d2xsok1, d2xsok2, d2xsom1, d2xsom2, d2xsoo1, d2xsoo2, d2xsoq1, d2xsoq2, d2xsos1, d2xsos2, d2xsou1, d2xsou2, d2xsow1, d2xsow2
   automated match to d1wqlb1
   complexed with fe2, fes

Details for d2xsob_

PDB Entry: 2xso, 2.2 Å

PDB Description: crystal structure of p4 variant of biphenyl dioxygenase from burkholderia xenovorans lb400

PDB Compounds: (B:) Biphenyl dioxygenase subunit beta

SCOPe Domain Sequences for d2xsob_:

Sequence; same for both SEQRES and ATOM records:

>d2xsob_ d.17.4.4 (B:) automated matches {Burkholderia xenovorans [TaxId: 266265]}
phffktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmplrtnrm
iregeleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivketatp
dtfevnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastllsnnls
mff

Timeline for d2xsob_:

• d2xsob_ first appeared in SCOPe 2.01
  
• d2xsob_ appears in SCOPe 2.07