Lineage for d2r63a_ (2r63 A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1268060Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 1268061Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 1268082Family a.35.1.2: Phage repressors [47419] (7 proteins)
    consists of different sequence families of HTH repressors of phage origins
  6. 1268083Protein 434 C1 repressor, DNA-binding domain [47422] (1 species)
  7. 1268084Species Bacteriophage 434 [TaxId:10712] [47423] (8 PDB entries)
    Uniprot P16117 10-62; contains a short additional helix at C-terminus
  8. 1268094Domain d2r63a_: 2r63 A: [17036]

Details for d2r63a_

PDB Entry: 2r63 (more details)

PDB Description: structural role of a buried salt bridge in the 434 repressor dna- binding domain, nmr, 20 structures
PDB Compounds: (A:) repressor protein from bacteriophage 434

SCOPe Domain Sequences for d2r63a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r63a_ a.35.1.2 (A:) 434 C1 repressor, DNA-binding domain {Bacteriophage 434 [TaxId: 10712]}
sissrvkskmiqlglnqaelaqkvgttqqsieqlengktkrprflpelasalgvsvdwll
ngt

SCOPe Domain Coordinates for d2r63a_:

Click to download the PDB-style file with coordinates for d2r63a_.
(The format of our PDB-style files is described here.)

Timeline for d2r63a_: