Lineage for d2r63__ (2r63 -)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 442266Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 442267Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (6 families) (S)
  5. 442288Family a.35.1.2: Phage repressors [47419] (7 proteins)
    consists of different sequence families of HTH repressors of phage origins
  6. 442289Protein 434 C1 repressor, DNA-binding domain [47422] (1 species)
  7. 442290Species Bacteriophage 434 [TaxId:10712] [47423] (8 PDB entries)
    contains a short additional helix at C-terminus
  8. 442298Domain d2r63__: 2r63 - [17036]

Details for d2r63__

PDB Entry: 2r63 (more details)

PDB Description: structural role of a buried salt bridge in the 434 repressor dna- binding domain, nmr, 20 structures

SCOP Domain Sequences for d2r63__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r63__ a.35.1.2 (-) 434 C1 repressor, DNA-binding domain {Bacteriophage 434}
sissrvkskmiqlglnqaelaqkvgttqqsieqlengktkrprflpelasalgvsvdwll
ngt

SCOP Domain Coordinates for d2r63__:

Click to download the PDB-style file with coordinates for d2r63__.
(The format of our PDB-style files is described here.)

Timeline for d2r63__: