Class a: All alpha proteins [46456] (218 folds) |
Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (6 families) |
Family a.35.1.2: Phage repressors [47419] (7 proteins) consists of different sequence families of HTH repressors of phage origins |
Protein 434 C1 repressor, DNA-binding domain [47422] (1 species) |
Species Bacteriophage 434 [TaxId:10712] [47423] (8 PDB entries) contains a short additional helix at C-terminus |
Domain d2r63__: 2r63 - [17036] |
PDB Entry: 2r63 (more details)
SCOP Domain Sequences for d2r63__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r63__ a.35.1.2 (-) 434 C1 repressor, DNA-binding domain {Bacteriophage 434} sissrvkskmiqlglnqaelaqkvgttqqsieqlengktkrprflpelasalgvsvdwll ngt
Timeline for d2r63__: