SCOPe 2.08: Domain d2xsjf_: 2xsj F:

Lineage for d2xsjf_ (2xsj F:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.203: DsrC, the gamma subunit of dissimilatory sulfite reductase [69720] (1 superfamily)
   beta(3)-alpha(5); meander beta-sheet packed against array of helices

4. Superfamily d.203.1: DsrC, the gamma subunit of dissimilatory sulfite reductase [69721] (2 families)

5. Family d.203.1.1: DsrC, the gamma subunit of dissimilatory sulfite reductase [69722] (2 proteins)
   automatically mapped to Pfam PF04358

6. Protein automated matches [191191] (2 species)
   not a true protein

7. Species Desulfomicrobium norvegicum [TaxId:52561] [189713] (1 PDB entry)

8. Domain d2xsjf_: 2xsj F: [170359]
   automated match to d2v4jc1
   complexed with sf4, so3, srm

Details for d2xsjf_

PDB Entry: 2xsj, 2.53 Å

PDB Description: structure of desulforubidin from desulfomicrobium norvegicum

PDB Compounds: (F:) sulfur relay protein, tuse/dsrc/dsvc family

SCOPe Domain Sequences for d2xsjf_:

Sequence; same for both SEQRES and ATOM records:

>d2xsjf_ d.203.1.1 (F:) automated matches {Desulfomicrobium norvegicum [TaxId: 52561]}
amiefkgksfeidedgfllkfedwgpewaeyvkesegiseiteahqqildflqdyykkng
iapmvrilskstgyklkqiyelfpsgpgkgackmaglpkptgcv

Timeline for d2xsjf_:

• d2xsjf_ first appeared in SCOPe 2.01
  
• d2xsjf_ appears in SCOPe 2.07