SCOPe 2.01: Domain d2xshh_: 2xsh H:

Lineage for d2xshh_ (2xsh H:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins)
   Pfam PF00866

6. Protein automated matches [190223] (3 species)
   not a true protein

7. Species Burkholderia xenovorans [TaxId:266265] [189543] (6 PDB entries)

8. Domain d2xshh_: 2xsh H: [170355]
   automated match to d1wqlb1
   complexed with dc5, fe2, fes

Details for d2xshh_

PDB Entry: 2xsh, 2.29 Å

PDB Description: crystal structure of p4 variant of biphenyl dioxygenase from burkholderia xenovorans lb400 in complex with 2,6 di chlorobiphenyl

PDB Compounds: (H:) Biphenyl dioxygenase subunit beta

SCOPe Domain Sequences for d2xshh_:

Sequence; same for both SEQRES and ATOM records:

>d2xshh_ d.17.4.4 (H:) automated matches {Burkholderia xenovorans [TaxId: 266265]}
fktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmplrtnrmire
geleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivketatpdtf
evnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastllsnnlsmff

Timeline for d2xshh_:

• d2xshh_ is new in SCOPe 2.01-stable
  
• d2xshh_ appears in SCOPe 2.02
  
• d2xshh_ appears in the current release, SCOPe 2.08