Lineage for d1r63__ (1r63 -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 2993Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
  4. 2994Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (5 families) (S)
  5. 3006Family a.35.1.2: Phage repressors [47419] (6 proteins)
  6. 3007Protein 434 C1 repressor, DNA-binding domain [47422] (1 species)
  7. 3008Species Bacteriophage 434 (Escherichia coli) [TaxId:10712] [47423] (7 PDB entries)
  8. 3016Domain d1r63__: 1r63 - [17035]

Details for d1r63__

PDB Entry: 1r63 (more details)

PDB Description: structural role of a buried salt bridge in the 434 repressor dna- binding domain, nmr, 20 structures

SCOP Domain Sequences for d1r63__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r63__ a.35.1.2 (-) 434 C1 repressor, DNA-binding domain {Bacteriophage 434 (Escherichia coli)}
sissrvkskriqlglnqaelaqkvgttqqsieqlengktkrprflpelasalgvsvdwll
ngt

SCOP Domain Coordinates for d1r63__:

Click to download the PDB-style file with coordinates for d1r63__.
(The format of our PDB-style files is described here.)

Timeline for d1r63__: