SCOPe 2.05: Domain d2xsca_: 2xsc A:

Lineage for d2xsca_ (2xsc A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)

6. Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (4 species)
   phage-borne toxin; bacteriophages H30 and H19B

7. Species Escherichia coli [TaxId:562] [50211] (14 PDB entries)

8. Domain d2xsca_: 2xsc A: [170347]
   automated match to d1bosa_
   complexed with zn

Details for d2xsca_

PDB Entry: 2xsc, 2.05 Å

PDB Description: crystal structure of the cell-binding b oligomer of verotoxin-1 from e. coli

PDB Compounds: (A:) shiga-like toxin 1 subunit b

SCOPe Domain Sequences for d2xsca_:

Sequence; same for both SEQRES and ATOM records:

>d2xsca_ b.40.2.1 (A:) Verotoxin-1/shiga-toxin, B-pentamer {Escherichia coli [TaxId: 562]}
tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
ggfsevifr

Timeline for d2xsca_:

• d2xsca_ first appeared in SCOPe 2.01
  
• d2xsca_ appears in SCOPe 2.04
  
• d2xsca_ appears in SCOPe 2.06
  
• d2xsca_ appears in the current release, SCOPe 2.08