Lineage for d1rper_ (1rpe R:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1268060Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 1268061Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 1268082Family a.35.1.2: Phage repressors [47419] (7 proteins)
    consists of different sequence families of HTH repressors of phage origins
  6. 1268083Protein 434 C1 repressor, DNA-binding domain [47422] (1 species)
  7. 1268084Species Bacteriophage 434 [TaxId:10712] [47423] (8 PDB entries)
    Uniprot P16117 10-62; contains a short additional helix at C-terminus
  8. 1268091Domain d1rper_: 1rpe R: [17034]
    protein/DNA complex

Details for d1rper_

PDB Entry: 1rpe (more details), 2.5 Å

PDB Description: the phage 434 or2/r1-69 complex at 2.5 angstroms resolution
PDB Compounds: (R:) protein (434 repressor)

SCOPe Domain Sequences for d1rper_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rper_ a.35.1.2 (R:) 434 C1 repressor, DNA-binding domain {Bacteriophage 434 [TaxId: 10712]}
sissrvkskriqlglnqaelaqkvgttqqsieqlengktkrprflpelasalgvsvdwll
ngt

SCOPe Domain Coordinates for d1rper_:

Click to download the PDB-style file with coordinates for d1rper_.
(The format of our PDB-style files is described here.)

Timeline for d1rper_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1rpel_