Class a: All alpha proteins [46456] (284 folds) |
Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) |
Family a.35.1.2: Phage repressors [47419] (7 proteins) consists of different sequence families of HTH repressors of phage origins |
Protein 434 C1 repressor, DNA-binding domain [47422] (1 species) |
Species Bacteriophage 434 [TaxId:10712] [47423] (8 PDB entries) Uniprot P16117 10-62; contains a short additional helix at C-terminus |
Domain d1rper_: 1rpe R: [17034] protein/DNA complex |
PDB Entry: 1rpe (more details), 2.5 Å
SCOPe Domain Sequences for d1rper_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rper_ a.35.1.2 (R:) 434 C1 repressor, DNA-binding domain {Bacteriophage 434 [TaxId: 10712]} sissrvkskriqlglnqaelaqkvgttqqsieqlengktkrprflpelasalgvsvdwll ngt
Timeline for d1rper_: