Lineage for d1rper_ (1rpe R:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (5 families) 
Family a.35.1.2: Phage repressors [47419] (6 proteins) 
Protein 434 C1 repressor, DNA-binding domain [47422] (1 species) Species Bacteriophage 434 (Escherichia coli) [TaxId:10712] [47423] (7 PDB entries) 
Domain d1rper_: 1rpe R: [17034]
Details for d1rper_
PDB Entry: 1rpe (more details), 2.5 Å
PDB Description: the phage 434 or2/r1-69 complex at 2.5 angstroms resolution
SCOP Domain Sequences for d1rper_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rper_ a.35.1.2 (R:) 434 C1 repressor, DNA-binding domain {Bacteriophage 434 (Escherichia coli)}
sissrvkskriqlglnqaelaqkvgttqqsieqlengktkrprflpelasalgvsvdwll
ngt
SCOP Domain Coordinates for d1rper_:
Click to download the PDB-style file with coordinates for d1rper_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1rper_:
- d1rper_ appears in SCOP 1.57
- d1rper_ appears in the current release, SCOPe 2.08
View in 3D
