SCOPe 2.05: Domain d1rpel_: 1rpe L:

Lineage for d1rpel_ (1rpe L:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.2: Phage repressors [47419] (7 proteins)
   consists of different sequence families of HTH repressors of phage origins

6. Protein 434 C1 repressor, DNA-binding domain [47422] (1 species)

7. Species Bacteriophage 434 [TaxId:10712] [47423] (8 PDB entries)
   Uniprot P16117 10-62; contains a short additional helix at C-terminus

8. Domain d1rpel_: 1rpe L: [17033]
   protein/DNA complex

Details for d1rpel_

PDB Entry: 1rpe, 2.5 Å

PDB Description: the phage 434 or2/r1-69 complex at 2.5 angstroms resolution

PDB Compounds: (L:) protein (434 repressor)

SCOPe Domain Sequences for d1rpel_:

Sequence; same for both SEQRES and ATOM records:

>d1rpel_ a.35.1.2 (L:) 434 C1 repressor, DNA-binding domain {Bacteriophage 434 [TaxId: 10712]}
sissrvkskriqlglnqaelaqkvgttqqsieqlengktkrprflpelasalgvsvdwll
ngt

Timeline for d1rpel_:

• d1rpel_ first appeared (with stable ids) in SCOP 1.55
  
• d1rpel_ appears in SCOPe 2.04
  
• d1rpel_ appears in SCOPe 2.06
  
• d1rpel_ appears in the current release, SCOPe 2.08