Lineage for d2xrse_ (2xrs E:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1313473Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1313712Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 1313713Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 1313837Protein Heat-labile toxin [50205] (2 species)
  7. 1313838Species Escherichia coli, type IB [TaxId:562] [50206] (21 PDB entries)
  8. 1313875Domain d2xrse_: 2xrs E: [170324]
    automated match to d1djrd_
    complexed with gal

Details for d2xrse_

PDB Entry: 2xrs (more details), 1.81 Å

PDB Description: crystal structures exploring the origins of the broader specificity of escherichia coli heat-labile enterotoxin compared to cholera toxin
PDB Compounds: (E:) heat-labile enterotoxin b chain

SCOPe Domain Sequences for d2xrse_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xrse_ b.40.2.1 (E:) Heat-labile toxin {Escherichia coli, type IB [TaxId: 562]}
apqtitelcseyrntqiytindkilsytesmagkremviitfksgetfqvevpgsqhids
qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismkn

SCOPe Domain Coordinates for d2xrse_:

Click to download the PDB-style file with coordinates for d2xrse_.
(The format of our PDB-style files is described here.)

Timeline for d2xrse_: