SCOPe 2.06: Domain d2xrqg_: 2xrq G:

Lineage for d2xrqg_ (2xrq G:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)

6. Protein Heat-labile toxin [50205] (2 species)

7. Species Escherichia coli, type IB [TaxId:562] [50206] (22 PDB entries)

8. Domain d2xrqg_: 2xrq G: [170321]
   automated match to d1djrd_

Details for d2xrqg_

PDB Entry: 2xrq, 2.4 Å

PDB Description: crystal structures exploring the origins of the broader specificity of escherichia coli heat-labile enterotoxin compared to cholera toxin

PDB Compounds: (G:) heat-labile enterotoxin b chain

SCOPe Domain Sequences for d2xrqg_:

Sequence; same for both SEQRES and ATOM records:

>d2xrqg_ b.40.2.1 (G:) Heat-labile toxin {Escherichia coli, type IB [TaxId: 562]}
apqtitelcseyrntqiytindkilsytesmagkremviitfksgetfqvevpgsqhids
qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismkn

Timeline for d2xrqg_:

• d2xrqg_ first appeared in SCOPe 2.01
  
• d2xrqg_ appears in SCOPe 2.05
  
• d2xrqg_ appears in SCOPe 2.07
  
• d2xrqg_ appears in the current release, SCOPe 2.08