Lineage for d2or1r_ (2or1 R:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1087132Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 1087133Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 1087154Family a.35.1.2: Phage repressors [47419] (7 proteins)
    consists of different sequence families of HTH repressors of phage origins
  6. 1087155Protein 434 C1 repressor, DNA-binding domain [47422] (1 species)
  7. 1087156Species Bacteriophage 434 [TaxId:10712] [47423] (8 PDB entries)
    Uniprot P16117 10-62; contains a short additional helix at C-terminus
  8. 1087161Domain d2or1r_: 2or1 R: [17032]
    protein/DNA complex

Details for d2or1r_

PDB Entry: 2or1 (more details), 2.5 Å

PDB Description: recognition of a dna operator by the repressor of phage 434. a view at high resolution
PDB Compounds: (R:) 434 repressor

SCOPe Domain Sequences for d2or1r_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2or1r_ a.35.1.2 (R:) 434 C1 repressor, DNA-binding domain {Bacteriophage 434 [TaxId: 10712]}
sissrvkskriqlglnqaelaqkvgttqqsieqlengktkrprflpelasalgvsvdwll
ngt

SCOPe Domain Coordinates for d2or1r_:

Click to download the PDB-style file with coordinates for d2or1r_.
(The format of our PDB-style files is described here.)

Timeline for d2or1r_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2or1l_