Lineage for d2xreb_ (2xre B:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1191813Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 1191814Superfamily d.3.1: Cysteine proteinases [54001] (23 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 1192326Family d.3.1.7: Adenain-like [54054] (6 proteins)
    Pfam PF02902; Ulp1 protease family
  6. 1192365Protein automated matches [190219] (1 species)
    not a true protein
  7. 1192366Species Human (Homo sapiens) [TaxId:9606] [186979] (4 PDB entries)
  8. 1192374Domain d2xreb_: 2xre B: [170317]
    automated match to d2ckha1
    complexed with co, gol

Details for d2xreb_

PDB Entry: 2xre (more details), 2.45 Å

PDB Description: detection of cobalt in previously unassigned human senp1 structure
PDB Compounds: (B:) sentrin-specific protease 1

SCOPe Domain Sequences for d2xreb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xreb_ d.3.1.7 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
efpeiteemekeiknvfrngnqdevlseafrltitrkdiqtlnhlnwlndeiinfymnml
merskekglpsvhafntffftklktagyqavkrwtkkvdvfsvdillvpihlgvhwclav
vdfrkknityydsmgginneacrillqylkqesidkkrkefdtngwqlfskksqeipqqm
ngsdcgmfackyadcitkdrpinftqqhmpyfrkrmvweilhrkll

SCOPe Domain Coordinates for d2xreb_:

Click to download the PDB-style file with coordinates for d2xreb_.
(The format of our PDB-style files is described here.)

Timeline for d2xreb_: