Lineage for d2xr0a_ (2xr0 A:)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2244155Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2244156Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2244157Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 2244418Protein beta-Lactamase, class A [56606] (16 species)
  7. 2244557Species Escherichia coli, TOHO-1 [TaxId:562] [56608] (26 PDB entries)
  8. 2244575Domain d2xr0a_: 2xr0 A: [170303]
    automated match to d1iysa_
    complexed with so4; mutant

Details for d2xr0a_

PDB Entry: 2xr0 (more details), 2.2 Å

PDB Description: room temperature x-ray structure of the perdeuterated toho-1 r274n r276n double mutant beta-lactamase
PDB Compounds: (A:) Toho-1 beta-lactamase

SCOPe Domain Sequences for d2xr0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xr0a_ e.3.1.1 (A:) beta-Lactamase, class A {Escherichia coli, TOHO-1 [TaxId: 562]}
svqqqlealekssggrlgvalintadnsqilyraderfamcstskvmaaaavlkqsesdk
hllnqrveikksdlvnynpiaekhvngtmtlaelgaaalqysdntamnkliahlggpdkv
tafarslgdetfrldrteptlntaipgdprdtttplamaqtlknltlgkalaetqraqlv
twlkgnttgsasiraglpkswvvgdktgsgdygttndiaviwpenhaplvlvtyftqpeq
kaenrndilaaaakivthgf

SCOPe Domain Coordinates for d2xr0a_:

Click to download the PDB-style file with coordinates for d2xr0a_.
(The format of our PDB-style files is described here.)

Timeline for d2xr0a_: