Lineage for d2xqrl_ (2xqr L:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319937Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2322003Superfamily a.29.6: Plant invertase/pectin methylesterase inhibitor [101148] (2 families) (S)
    contains a short alpha-hairpin at the N-terminal extension
  5. 2322004Family a.29.6.1: Plant invertase/pectin methylesterase inhibitor [101149] (3 proteins)
    Pfam PF04043
  6. 2322020Protein automated matches [190250] (1 species)
    not a true protein
  7. 2322021Species Tobacco (Nicotiana tabacum) [TaxId:4097] [187032] (6 PDB entries)
  8. 2322032Domain d2xqrl_: 2xqr L: [170298]
    automated match to d1rj1a_
    complexed with epe, fru, nag, so4

Details for d2xqrl_

PDB Entry: 2xqr (more details), 2.58 Å

PDB Description: crystal structure of plant cell wall invertase in complex with a specific protein inhibitor
PDB Compounds: (L:) invertase inhibitor

SCOPe Domain Sequences for d2xqrl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xqrl_ a.29.6.1 (L:) automated matches {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
nlvettckntpnyqlclktllsdkrsatgdittlalimvdaikakanqaavtisklrhsn
ppaawkgplkncafsykviltaslpeaiealtkgdpkfaedgmvgssgdaqeceeyfkgs
kspfsalniavhelsdvgraivrnll

SCOPe Domain Coordinates for d2xqrl_:

Click to download the PDB-style file with coordinates for d2xqrl_.
(The format of our PDB-style files is described here.)

Timeline for d2xqrl_: