SCOPe 2.05: Domain d2xqrj_: 2xqr J:

Lineage for d2xqrj_ (2xqr J:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.6: Plant invertase/pectin methylesterase inhibitor [101148] (2 families)
   contains a short alpha-hairpin at the N-terminal extension

5. Family a.29.6.1: Plant invertase/pectin methylesterase inhibitor [101149] (3 proteins)
   Pfam PF04043

6. Protein automated matches [190250] (1 species)
   not a true protein

7. Species Tobacco (Nicotiana tabacum) [TaxId:4097] [187032] (6 PDB entries)

8. Domain d2xqrj_: 2xqr J: [170297]
   automated match to d1rj1a_
   complexed with epe, fru, nag, so4

Details for d2xqrj_

PDB Entry: 2xqr, 2.58 Å

PDB Description: crystal structure of plant cell wall invertase in complex with a specific protein inhibitor

PDB Compounds: (J:) invertase inhibitor

SCOPe Domain Sequences for d2xqrj_:

Sequence; same for both SEQRES and ATOM records:

>d2xqrj_ a.29.6.1 (J:) automated matches {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
nlvettckntpnyqlclktllsdkrsatgdittlalimvdaikakanqaavtisklrhsn
ppaawkgplkncafsykviltaslpeaiealtkgdpkfaedgmvgssgdaqeceeyfkgs
kspfsalniavhelsdvgraivrnll

Timeline for d2xqrj_:

• d2xqrj_ first appeared in SCOPe 2.01
  
• d2xqrj_ appears in SCOPe 2.04
  
• d2xqrj_ appears in SCOPe 2.06
  
• d2xqrj_ appears in the current release, SCOPe 2.08