Lineage for d2xqrj_ (2xqr J:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1086488Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1086744Superfamily a.29.6: Plant invertase/pectin methylesterase inhibitor [101148] (2 families) (S)
    contains a short alpha-hairpin at the N-terminal extension
  5. 1086745Family a.29.6.1: Plant invertase/pectin methylesterase inhibitor [101149] (3 proteins)
    Pfam PF04043
  6. 1086761Protein automated matches [190250] (1 species)
    not a true protein
  7. 1086762Species Tobacco (Nicotiana tabacum) [TaxId:4097] [187032] (6 PDB entries)
  8. 1086772Domain d2xqrj_: 2xqr J: [170297]
    automated match to d1rj1a_
    complexed with epe, fru, nag, so4

Details for d2xqrj_

PDB Entry: 2xqr (more details), 2.58 Å

PDB Description: crystal structure of plant cell wall invertase in complex with a specific protein inhibitor
PDB Compounds: (J:) invertase inhibitor

SCOPe Domain Sequences for d2xqrj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xqrj_ a.29.6.1 (J:) automated matches {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
nlvettckntpnyqlclktllsdkrsatgdittlalimvdaikakanqaavtisklrhsn
ppaawkgplkncafsykviltaslpeaiealtkgdpkfaedgmvgssgdaqeceeyfkgs
kspfsalniavhelsdvgraivrnll

SCOPe Domain Coordinates for d2xqrj_:

Click to download the PDB-style file with coordinates for d2xqrj_.
(The format of our PDB-style files is described here.)

Timeline for d2xqrj_: