Lineage for d2xqnm_ (2xqn M:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1550800Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 1550801Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 1551176Family b.55.1.4: Enabled/VASP homology 1 domain (EVH1 domain) [50767] (7 proteins)
  6. 1551184Protein Enabled [50768] (2 species)
  7. 1551185Species Human (Homo sapiens) [TaxId:9606] [159215] (2 PDB entries)
  8. 1551190Domain d2xqnm_: 2xqn M: [170292]
    automated match to d1evha_
    complexed with zn

Details for d2xqnm_

PDB Entry: 2xqn (more details), 2.62 Å

PDB Description: complex of the 2nd and 3rd lim domains of tes with the evh1 domain of mena and the n-terminal domain of actin-like protein arp7a
PDB Compounds: (M:) enabled homolog

SCOPe Domain Sequences for d2xqnm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xqnm_ b.55.1.4 (M:) Enabled {Human (Homo sapiens) [TaxId: 9606]}
aarmseqsicqaraavmvyddankkwvpaggstgfsrvhiyhhtgnntfrvvgrkiqdhq
vvincaipkglkynqatqtfhqwrdarqvyglnfgskedanvfasammhalevlns

SCOPe Domain Coordinates for d2xqnm_:

Click to download the PDB-style file with coordinates for d2xqnm_.
(The format of our PDB-style files is described here.)

Timeline for d2xqnm_: