SCOPe 2.03: Domain d2xqnm_: 2xqn M:

Lineage for d2xqnm_ (2xqn M:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.4: Enabled/VASP homology 1 domain (EVH1 domain) [50767] (7 proteins)

6. Protein Enabled [50768] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [159215] (2 PDB entries)

8. Domain d2xqnm_: 2xqn M: [170292]
   automated match to d1evha_
   complexed with zn

Details for d2xqnm_

PDB Entry: 2xqn, 2.62 Å

PDB Description: complex of the 2nd and 3rd lim domains of tes with the evh1 domain of mena and the n-terminal domain of actin-like protein arp7a

PDB Compounds: (M:) enabled homolog

SCOPe Domain Sequences for d2xqnm_:

Sequence; same for both SEQRES and ATOM records:

>d2xqnm_ b.55.1.4 (M:) Enabled {Human (Homo sapiens) [TaxId: 9606]}
aarmseqsicqaraavmvyddankkwvpaggstgfsrvhiyhhtgnntfrvvgrkiqdhq
vvincaipkglkynqatqtfhqwrdarqvyglnfgskedanvfasammhalevlns

Timeline for d2xqnm_:

• d2xqnm_ first appeared in SCOPe 2.01
  
• d2xqnm_ appears in SCOPe 2.02
  
• d2xqnm_ appears in SCOPe 2.04
  
• d2xqnm_ appears in the current release, SCOPe 2.08, called d2xqnm1