Lineage for d2xqba_ (2xqb A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2705447Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 2705448Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 2705548Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)
  6. 2705721Protein automated matches [190501] (4 species)
    not a true protein
  7. 2705722Species Human (Homo sapiens) [TaxId:9606] [187448] (21 PDB entries)
  8. 2705762Domain d2xqba_: 2xqb A: [170286]
    Other proteins in same PDB: d2xqbh_, d2xqbl1, d2xqbl2
    automated match to d2z3qa1
    complexed with so4

Details for d2xqba_

PDB Entry: 2xqb (more details), 2.6 Å

PDB Description: crystal structure of anti-il-15 antibody in complex with human il-15
PDB Compounds: (A:) interleukin 15

SCOPe Domain Sequences for d2xqba_:

Sequence, based on SEQRES records: (download)

>d2xqba_ a.26.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nwvnvisdlkkiedliqsmhidatlytesdvhpsckvtamkcfllelqvislesgdasih
dtvenliilannslssngnvtesgckeceeleeknikeflqsfvhivqmfint

Sequence, based on observed residues (ATOM records): (download)

>d2xqba_ a.26.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nwvnvisdlkkiedliqidatlytesdvhpsckvtamkcfllelqvislesgdasihdtv
enliilannslstesgckeceeleeknikeflqsfvhivqmfint

SCOPe Domain Coordinates for d2xqba_:

Click to download the PDB-style file with coordinates for d2xqba_.
(The format of our PDB-style files is described here.)

Timeline for d2xqba_: