SCOP 1.75: Domain d1r69a_: 1r69 A:

Lineage for d1r69a_ (1r69 A:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (13 families)

5. Family a.35.1.2: Phage repressors [47419] (7 proteins)
   consists of different sequence families of HTH repressors of phage origins

6. Protein 434 C1 repressor, DNA-binding domain [47422] (1 species)

7. Species Bacteriophage 434 [TaxId:10712] [47423] (8 PDB entries)
   Uniprot P16117 10-62; contains a short additional helix at C-terminus

8. Domain d1r69a_: 1r69 A: [17028]

Details for d1r69a_

PDB Entry: 1r69, 2 Å

PDB Description: structure of the amino-terminal domain of phage 434 repressor at 2.0 angstroms resolution

PDB Compounds: (A:) repressor protein ci

SCOP Domain Sequences for d1r69a_:

Sequence; same for both SEQRES and ATOM records:

>d1r69a_ a.35.1.2 (A:) 434 C1 repressor, DNA-binding domain {Bacteriophage 434 [TaxId: 10712]}
sissrvkskriqlglnqaelaqkvgttqqsieqlengktkrprflpelasalgvsvdwll
ngt

Timeline for d1r69a_:

• d1r69a_ first appeared (with stable ids) in SCOP 1.55, called d1r69__
  
• d1r69a_ appears in SCOP 1.73
  
• d1r69a_ appears in SCOPe 2.01
  
• d1r69a_ appears in the current release, SCOPe 2.08