Lineage for d1r69__ (1r69 -)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 537254Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 537255Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (8 families) (S)
  5. 537276Family a.35.1.2: Phage repressors [47419] (7 proteins)
    consists of different sequence families of HTH repressors of phage origins
  6. 537277Protein 434 C1 repressor, DNA-binding domain [47422] (1 species)
  7. 537278Species Bacteriophage 434 [TaxId:10712] [47423] (8 PDB entries)
  8. 537279Domain d1r69__: 1r69 - [17028]

Details for d1r69__

PDB Entry: 1r69 (more details), 2 Å

PDB Description: structure of the amino-terminal domain of phage 434 repressor at 2.0 angstroms resolution

SCOP Domain Sequences for d1r69__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r69__ a.35.1.2 (-) 434 C1 repressor, DNA-binding domain {Bacteriophage 434}
sissrvkskriqlglnqaelaqkvgttqqsieqlengktkrprflpelasalgvsvdwll
ngt

SCOP Domain Coordinates for d1r69__:

Click to download the PDB-style file with coordinates for d1r69__.
(The format of our PDB-style files is described here.)

Timeline for d1r69__: