![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
![]() | Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) ![]() |
![]() | Family a.35.1.2: Phage repressors [47419] (7 proteins) consists of different sequence families of HTH repressors of phage origins |
![]() | Protein 434 C1 repressor, DNA-binding domain [47422] (1 species) |
![]() | Species Bacteriophage 434 [TaxId:10712] [47423] (8 PDB entries) Uniprot P16117 10-62; contains a short additional helix at C-terminus |
![]() | Domain d1r69a_: 1r69 A: [17028] |
PDB Entry: 1r69 (more details), 2 Å
SCOPe Domain Sequences for d1r69a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r69a_ a.35.1.2 (A:) 434 C1 repressor, DNA-binding domain {Bacteriophage 434 [TaxId: 10712]} sissrvkskriqlglnqaelaqkvgttqqsieqlengktkrprflpelasalgvsvdwll ngt
Timeline for d1r69a_: