Lineage for d2xq1b_ (2xq1 B:)

  1. Root: SCOPe 2.02
  2. 1232558Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1233542Fold e.5: Heme-dependent catalase-like [56633] (1 superfamily)
    contains an (8,10) beta-barrel and an all-alpha domain
  4. 1233543Superfamily e.5.1: Heme-dependent catalase-like [56634] (2 families) (S)
  5. 1233544Family e.5.1.1: Heme-dependent catalases [56635] (3 proteins)
  6. 1233689Protein automated matches [190051] (4 species)
    not a true protein
  7. 1233707Species Pichia angusta [TaxId:4905] [190000] (1 PDB entry)
  8. 1233709Domain d2xq1b_: 2xq1 B: [170271]
    automated match to d1a4ea_
    complexed with hem

Details for d2xq1b_

PDB Entry: 2xq1 (more details), 2.9 Å

PDB Description: Crystal structure of peroxisomal catalase from the yeast Hansenula polymorpha
PDB Compounds: (B:) peroxisomal catalase

SCOPe Domain Sequences for d2xq1b_:

Sequence, based on SEQRES records: (download)

>d2xq1b_ e.5.1.1 (B:) automated matches {Pichia angusta [TaxId: 4905]}
anppvfttsqgcpvsdpfttqripldstgykyappigplllqdfklidtlshfdreripe
rvvhakgagaygvfevtdditdvcsakfldtvgkktriftrfstvggekgsadtardprg
fatkfytedgnldlvynntpiffirdpikfphfihtqkrnpatnlkdpnmfwdyltande
slhqvmylfsnrgtpasyrtmngysghtykwynskgewvyvqvhfianqgvhnlldeeag
rlagedpdhstrdlweaiekgdypswecyiqtmtleqskklpfsvfdltkvwphkdfplr
hfgrftlnenpknyyaeteqiafspshtvpgmepsndpvlqsrlfsypdthrhrlgpnyh
qipvncplksgsfnpinrdgpmcvdgnlggtpnyanayncpiqyavspkasgnkpdekyt
gevvpyhwehtdydyfqpkmfwkvlgrtpgeqeslvknvanhvsaadefiqdrvyeyfsk
aepiigdlirkkvqelkrka

Sequence, based on observed residues (ATOM records): (download)

>d2xq1b_ e.5.1.1 (B:) automated matches {Pichia angusta [TaxId: 4905]}
anppvfttsqgcpvsdpfttqripldstgykyappigplllqdfklidtlshfdreripe
rvvhakgagaygvfevtdditdvcsakfldtvgkktriftrfstvggekgsadtardprg
fatkfytedgnldlvynntpiffirdpikfphfihtqkrnpatnlkdpnmfwdyltande
slhqvmylfsnrgtpasyrtmngysghtykwynskgewvyvqvhfianqgvhnlldeeag
rlagedpdhstrdlweaiekgdypswecyiqtmtleqskklpfsvfdltkvwphkdfplr
hfgrftlnenpknyyaeteqiafspshtvpgmepsndpvlqsrlfsypdthrhrlgpnyh
qipvncplksgsfnpinrdgpmcvdgnlggtpnyanayncpiqyavnkpdekytgevvpy
hwehtdydyfqpkmfwkvlgrtpgeqeslvknvanhvsaadefiqdrvyeyfskaepiig
dlirkkvqelkrka

SCOPe Domain Coordinates for d2xq1b_:

Click to download the PDB-style file with coordinates for d2xq1b_.
(The format of our PDB-style files is described here.)

Timeline for d2xq1b_: