Lineage for d1lrpa_ (1lrp A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 913577Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 913578Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 913599Family a.35.1.2: Phage repressors [47419] (7 proteins)
    consists of different sequence families of HTH repressors of phage origins
  6. 913646Protein lambda C1 repressor, DNA-binding domain [47420] (1 species)
  7. 913647Species Bacteriophage lambda [TaxId:10710] [47421] (4 PDB entries)
  8. 913654Domain d1lrpa_: 1lrp A: [17027]
    CA-atoms only

Details for d1lrpa_

PDB Entry: 1lrp (more details), 3.2 Å

PDB Description: comparison of the structures of cro and lambda repressor proteins from bacteriophage lambda
PDB Compounds: (A:) lambda repressor

SCOPe Domain Sequences for d1lrpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lrpa_ a.35.1.2 (A:) lambda C1 repressor, DNA-binding domain {Bacteriophage lambda [TaxId: 10710]}
kkpltqeqledarrlkaiyekkknelglsqesvadkmgmgqsgvgalfnginalnaynaa
llakilkvsveefspsiareiyemyeavs

SCOPe Domain Coordinates for d1lrpa_:

Click to download the PDB-style file with coordinates for d1lrpa_.
(The format of our PDB-style files is described here.)

Timeline for d1lrpa_: