Lineage for d1lrp__ (1lrp -)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 47323Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
  4. 47324Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (5 families) (S)
  5. 47337Family a.35.1.2: Phage repressors [47419] (6 proteins)
  6. 47377Protein lambda C1 repressor, DNA-binding domain [47420] (1 species)
  7. 47378Species Bacteriophage lambda (Escherichia coli) [TaxId:10710] [47421] (3 PDB entries)
  8. 47383Domain d1lrp__: 1lrp - [17027]

Details for d1lrp__

PDB Entry: 1lrp (more details), 3.2 Å

PDB Description: comparison of the structures of cro and lambda repressor proteins from bacteriophage lambda

SCOP Domain Sequences for d1lrp__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lrp__ a.35.1.2 (-) lambda C1 repressor, DNA-binding domain {Bacteriophage lambda (Escherichia coli)}
kkpltqeqledarrlkaiyekkknelglsqesvadkmgmgqsgvgalfnginalnaynaa
llakilkvsveefspsiareiyemyeavs

SCOP Domain Coordinates for d1lrp__:

Click to download the PDB-style file with coordinates for d1lrp__.
(The format of our PDB-style files is described here.)

Timeline for d1lrp__: