Lineage for d1lrpa_ (1lrp A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. Family a.35.1.2: Phage repressors [47419] (7 proteins)
    consists of different sequence families of HTH repressors of phage origins
  6. Protein lambda C1 repressor, DNA-binding domain [47420] (1 species)
  7. Species Bacteriophage lambda [TaxId:10710] [47421] (5 PDB entries)
  8. Domain d1lrpa_: 1lrp A: [17027]
    CA-atoms only

Details for d1lrpa_

PDB Entry: 1lrp (more details), 3.2 Å

PDB Description: comparison of the structures of cro and lambda repressor proteins from bacteriophage lambda
PDB Compounds: (A:) lambda repressor

SCOPe Domain Sequences for d1lrpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lrpa_ a.35.1.2 (A:) lambda C1 repressor, DNA-binding domain {Bacteriophage lambda [TaxId: 10710]}
kkpltqeqledarrlkaiyekkknelglsqesvadkmgmgqsgvgalfnginalnaynaa
llakilkvsveefspsiareiyemyeavs

SCOPe Domain Coordinates for d1lrpa_ are not available.

Timeline for d1lrpa_:

Domains from other chains:
(mouse over for more information)
d1lrpb_, d1lrpc_