SCOPe 2.03: Domain d2xphb_: 2xph B:

Lineage for d2xphb_ (2xph B:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (23 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.7: Adenain-like [54054] (6 proteins)
   Pfam PF02902; Ulp1 protease family

6. Protein automated matches [190219] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186979] (5 PDB entries)

8. Domain d2xphb_: 2xph B: [170269]
   automated match to d2ckha1
   complexed with co, gol

Details for d2xphb_

PDB Entry: 2xph, 2.4 Å

PDB Description: Crystal structure of human SENP1 with the bound cobalt

PDB Compounds: (B:) sentrin-specific protease 1

SCOPe Domain Sequences for d2xphb_:

Sequence; same for both SEQRES and ATOM records:

>d2xphb_ d.3.1.7 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
efpeiteemekeiknvfrngnqdevlseafrltitrkdiqtlnhlnwlndeiinfymnml
merskekglpsvhafntffftklktagyqavkrwtkkvdvfsvdillvpihlgvhwclav
vdfrkknityydsmgginneacrillqylkqesidkkrkefdtngwqlfskksqeipqqm
ngsdcgmfackyadcitkdrpinftqqhmpyfrkrmvweilhrkll

Timeline for d2xphb_:

• d2xphb_ first appeared in SCOPe 2.01
  
• d2xphb_ appears in SCOPe 2.02
  
• d2xphb_ appears in SCOPe 2.04
  
• d2xphb_ appears in the current release, SCOPe 2.08