SCOPe 2.07: Domain d2xpha_: 2xph A:

Lineage for d2xpha_ (2xph A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.7: Adenain-like [54054] (6 proteins)
   Pfam PF02902; Ulp1 protease family

6. Protein automated matches [190219] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186979] (5 PDB entries)

8. Domain d2xpha_: 2xph A: [170268]
   automated match to d2ckha1
   complexed with co, gol

Details for d2xpha_

PDB Entry: 2xph, 2.4 Å

PDB Description: Crystal structure of human SENP1 with the bound cobalt

PDB Compounds: (A:) sentrin-specific protease 1

SCOPe Domain Sequences for d2xpha_:

Sequence; same for both SEQRES and ATOM records:

>d2xpha_ d.3.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
defpeiteemekeiknvfrngnqdevlseafrltitrkdiqtlnhlnwlndeiinfymnm
lmerskekglpsvhafntffftklktagyqavkrwtkkvdvfsvdillvpihlgvhwcla
vvdfrkknityydsmgginneacrillqylkqesidkkrkefdtngwqlfskksqeipqq
mngsdcgmfackyadcitkdrpinftqqhmpyfrkrmvweilhrkll

Timeline for d2xpha_:

• d2xpha_ first appeared in SCOPe 2.01
  
• d2xpha_ appears in SCOPe 2.06
  
• d2xpha_ appears in the current release, SCOPe 2.08