Lineage for d2xoxb_ (2xox B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 975118Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 975119Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 975436Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 976463Protein automated matches [190085] (29 species)
    not a true protein
  7. 976576Species Leishmania donovani [TaxId:5661] [189607] (1 PDB entry)
  8. 976578Domain d2xoxb_: 2xox B: [170266]
    automated match to d1e7wa_
    complexed with so4

Details for d2xoxb_

PDB Entry: 2xox (more details), 2.5 Å

PDB Description: crystal structure of pteridine reductase (ptr1) from leishmania donovani
PDB Compounds: (B:) pteridine reductase

SCOPe Domain Sequences for d2xoxb_:

Sequence, based on SEQRES records: (download)

>d2xoxb_ c.2.1.2 (B:) automated matches {Leishmania donovani [TaxId: 5661]}
tvpvalvtgaakrlgsgiaeglhaegyavclhyhrsaaeantlaatlnarrpnsaipvqa
dlsnvakapaggadgaapvtlfkrcadlvaacythwgrcdvlvnnassfyptpllrkded
ghvpcvgdreameaaaadlfgsnamapyflikafahrvadtpaeqrgtnysivnmvdamt
sqpllgytiytmakgalegltrsaalelaplqirvngvgpglsvladdmppavredyrsk
vplyqrdssaaevsdvviflcsskakyvtgtcvkvd

Sequence, based on observed residues (ATOM records): (download)

>d2xoxb_ c.2.1.2 (B:) automated matches {Leishmania donovani [TaxId: 5661]}
tvpvalvtgaakrlgsgiaeglhaegyavclhyhrsaaeantlaatlnarrpnsaipvqa
dlsnvapvtlfkrcadlvaacythwgrcdvlvnnreameaaaadlfgsnamapyflikaf
ahrvadtpaeqrgtnysivnmvdamtsqpllgytiytmakgalegltrsaalelaplqir
vngvgpglsaaevsdvviflcsskakyvtgtcvkvd

SCOPe Domain Coordinates for d2xoxb_:

Click to download the PDB-style file with coordinates for d2xoxb_.
(The format of our PDB-style files is described here.)

Timeline for d2xoxb_: