Lineage for d2xolb1 (2xol B:1-170)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2736108Fold a.184: TorD-like [89154] (1 superfamily)
    multihelical; bundle
  4. 2736109Superfamily a.184.1: TorD-like [89155] (1 family) (S)
  5. 2736110Family a.184.1.1: TorD-like [89156] (5 proteins)
    Pfam PF06192
  6. 2736126Protein automated matches [191026] (2 species)
    not a true protein
  7. 2736127Species Archaeoglobus fulgidus [TaxId:2234] [190016] (3 PDB entries)
  8. 2736129Domain d2xolb1: 2xol B:1-170 [170262]
    Other proteins in same PDB: d2xola2, d2xolb2
    automated match to d2idga1
    complexed with edo

Details for d2xolb1

PDB Entry: 2xol (more details), 1.35 Å

PDB Description: High resolution structure of TtrD from Archaeoglobus fulgidus
PDB Compounds: (B:) chaperone protein ttrd

SCOPe Domain Sequences for d2xolb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xolb1 a.184.1.1 (B:1-170) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
mtigrakvyatlskifyhlfydeaipkdcreiiekfgeidfnlrsvlvrelrgsvlikdm
pqslaevyesvmkdfyerygfqaselhadhiavelafmsklvereislaqqmkeeelyki
raaqhrfikahlqplvknlpsapllnfvrdfvredakylysslvgekneg

SCOPe Domain Coordinates for d2xolb1:

Click to download the PDB-style file with coordinates for d2xolb1.
(The format of our PDB-style files is described here.)

Timeline for d2xolb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2xolb2