Lineage for d2xola1 (2xol A:1-166)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2018429Fold a.184: TorD-like [89154] (1 superfamily)
    multihelical; bundle
  4. 2018430Superfamily a.184.1: TorD-like [89155] (1 family) (S)
  5. 2018431Family a.184.1.1: TorD-like [89156] (5 proteins)
    Pfam PF06192
  6. 2018447Protein automated matches [191026] (2 species)
    not a true protein
  7. 2018448Species Archaeoglobus fulgidus [TaxId:2234] [190016] (3 PDB entries)
  8. 2018449Domain d2xola1: 2xol A:1-166 [170261]
    Other proteins in same PDB: d2xola2, d2xolb2
    automated match to d2idga1
    complexed with edo

Details for d2xola1

PDB Entry: 2xol (more details), 1.35 Å

PDB Description: High resolution structure of TtrD from Archaeoglobus fulgidus
PDB Compounds: (A:) chaperone protein ttrd

SCOPe Domain Sequences for d2xola1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xola1 a.184.1.1 (A:1-166) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
mtigrakvyatlskifyhlfydeaipkdcreiiekfgeidfnlrsvlvrelrgsvlikdm
pqslaevyesvmkdfyerygfqaselhadhiavelafmsklvereislaqqmkeeelyki
raaqhrfikahlqplvknlpsapllnfvrdfvredakylysslvge

SCOPe Domain Coordinates for d2xola1:

Click to download the PDB-style file with coordinates for d2xola1.
(The format of our PDB-style files is described here.)

Timeline for d2xola1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2xola2