Class a: All alpha proteins [46456] (289 folds) |
Fold a.184: TorD-like [89154] (1 superfamily) multihelical; bundle |
Superfamily a.184.1: TorD-like [89155] (1 family) |
Family a.184.1.1: TorD-like [89156] (5 proteins) Pfam PF06192 |
Protein automated matches [191026] (2 species) not a true protein |
Species Archaeoglobus fulgidus [TaxId:2234] [190016] (3 PDB entries) |
Domain d2xola1: 2xol A:1-166 [170261] Other proteins in same PDB: d2xola2, d2xolb2 automated match to d2idga1 complexed with edo |
PDB Entry: 2xol (more details), 1.35 Å
SCOPe Domain Sequences for d2xola1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xola1 a.184.1.1 (A:1-166) automated matches {Archaeoglobus fulgidus [TaxId: 2234]} mtigrakvyatlskifyhlfydeaipkdcreiiekfgeidfnlrsvlvrelrgsvlikdm pqslaevyesvmkdfyerygfqaselhadhiavelafmsklvereislaqqmkeeelyki raaqhrfikahlqplvknlpsapllnfvrdfvredakylysslvge
Timeline for d2xola1: