SCOPe 2.08: Domain d2xola1: 2xol A:1-166

Lineage for d2xola1 (2xol A:1-166)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.184: TorD-like [89154] (1 superfamily)
   multihelical; bundle

4. Superfamily a.184.1: TorD-like [89155] (1 family)

5. Family a.184.1.1: TorD-like [89156] (5 proteins)
   Pfam PF06192

6. Protein automated matches [191026] (2 species)
   not a true protein

7. Species Archaeoglobus fulgidus [TaxId:2234] [190016] (3 PDB entries)

8. Domain d2xola1: 2xol A:1-166 [170261]
   Other proteins in same PDB: d2xola2, d2xolb2
   automated match to d2idga1
   complexed with edo

Details for d2xola1

PDB Entry: 2xol, 1.35 Å

PDB Description: High resolution structure of TtrD from Archaeoglobus fulgidus

PDB Compounds: (A:) chaperone protein ttrd

SCOPe Domain Sequences for d2xola1:

Sequence; same for both SEQRES and ATOM records:

>d2xola1 a.184.1.1 (A:1-166) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
mtigrakvyatlskifyhlfydeaipkdcreiiekfgeidfnlrsvlvrelrgsvlikdm
pqslaevyesvmkdfyerygfqaselhadhiavelafmsklvereislaqqmkeeelyki
raaqhrfikahlqplvknlpsapllnfvrdfvredakylysslvge

Timeline for d2xola1:

• d2xola1 first appeared in SCOPe 2.01, called d2xola_
  
• d2xola1 appears in SCOPe 2.07