Lineage for d1llib_ (1lli B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2709316Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 2709317Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 2709338Family a.35.1.2: Phage repressors [47419] (7 proteins)
    consists of different sequence families of HTH repressors of phage origins
  6. 2709386Protein lambda C1 repressor, DNA-binding domain [47420] (1 species)
  7. 2709387Species Bacteriophage lambda [TaxId:10710] [47421] (5 PDB entries)
  8. 2709395Domain d1llib_: 1lli B: [17026]
    protein/DNA complex; mutant

Details for d1llib_

PDB Entry: 1lli (more details), 2.1 Å

PDB Description: the crystal structure of a mutant protein with altered but improved hydrophobic core packing
PDB Compounds: (B:) protein (lambda repressor)

SCOPe Domain Sequences for d1llib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1llib_ a.35.1.2 (B:) lambda C1 repressor, DNA-binding domain {Bacteriophage lambda [TaxId: 10710]}
stkkkpltqeqledarrlkaiyekkknelglsqesladklgmgqsgigalfnginalnay
naallakilkvsveefspsiareiyemyeavs

SCOPe Domain Coordinates for d1llib_:

Click to download the PDB-style file with coordinates for d1llib_.
(The format of our PDB-style files is described here.)

Timeline for d1llib_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1llia_