SCOPe 2.04: Domain d1llia_: 1lli A:

Lineage for d1llia_ (1lli A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.2: Phage repressors [47419] (7 proteins)
   consists of different sequence families of HTH repressors of phage origins

6. Protein lambda C1 repressor, DNA-binding domain [47420] (1 species)

7. Species Bacteriophage lambda [TaxId:10710] [47421] (5 PDB entries)

8. Domain d1llia_: 1lli A: [17025]
   protein/DNA complex; mutant

Details for d1llia_

PDB Entry: 1lli, 2.1 Å

PDB Description: the crystal structure of a mutant protein with altered but improved hydrophobic core packing

PDB Compounds: (A:) protein (lambda repressor)

SCOPe Domain Sequences for d1llia_:

Sequence; same for both SEQRES and ATOM records:

>d1llia_ a.35.1.2 (A:) lambda C1 repressor, DNA-binding domain {Bacteriophage lambda [TaxId: 10710]}
kkpltqeqledarrlkaiyekkknelglsqesladklgmgqsgigalfnginalnaynaa
llakilkvsveefspsiareiyemyeavs

Timeline for d1llia_:

• d1llia_ first appeared (with stable ids) in SCOP 1.55
  
• d1llia_ appears in SCOPe 2.03
  
• d1llia_ appears in SCOPe 2.05
  
• d1llia_ appears in the current release, SCOPe 2.08