Lineage for d1llia_ (1lli A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 2993Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
  4. 2994Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (5 families) (S)
  5. 3006Family a.35.1.2: Phage repressors [47419] (6 proteins)
  6. 3046Protein lambda C1 repressor, DNA-binding domain [47420] (1 species)
  7. 3047Species Bacteriophage lambda (Escherichia coli) [TaxId:10710] [47421] (3 PDB entries)
  8. 3050Domain d1llia_: 1lli A: [17025]

Details for d1llia_

PDB Entry: 1lli (more details), 2.1 Å

PDB Description: the crystal structure of a mutant protein with altered but improved hydrophobic core packing

SCOP Domain Sequences for d1llia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1llia_ a.35.1.2 (A:) lambda C1 repressor, DNA-binding domain {Bacteriophage lambda (Escherichia coli)}
kkpltqeqledarrlkaiyekkknelglsqesladklgmgqsgigalfnginalnaynaa
llakilkvsveefspsiareiyemyeavs

SCOP Domain Coordinates for d1llia_:

Click to download the PDB-style file with coordinates for d1llia_.
(The format of our PDB-style files is described here.)

Timeline for d1llia_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1llib_