Lineage for d2xmwa_ (2xmw A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1026488Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1029142Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) (S)
  5. 1029249Family d.58.17.0: automated matches [191590] (1 protein)
    not a true family
  6. 1029250Protein automated matches [191063] (2 species)
    not a true protein
  7. 1029251Species Synechocystis sp. PCC 6803 [TaxId:1148] [189441] (1 PDB entry)
  8. 1029252Domain d2xmwa_: 2xmw A: [170246]
    automated match to d1kqka_
    complexed with cu1

Details for d2xmwa_

PDB Entry: 2xmw (more details), 1.8 Å

PDB Description: pacs, n-terminal domain, from synechocystis pcc6803
PDB Compounds: (A:) cation-transporting ATPase pacs

SCOPe Domain Sequences for d2xmwa_:

Sequence, based on SEQRES records: (download)

>d2xmwa_ d.58.17.0 (A:) automated matches {Synechocystis sp. PCC 6803 [TaxId: 1148]}
aqtinlqlegmrcaacassieraiakvpgvqscqvnfaleqavvsyhgettpqiltdave
ragyharvlk

Sequence, based on observed residues (ATOM records): (download)

>d2xmwa_ d.58.17.0 (A:) automated matches {Synechocystis sp. PCC 6803 [TaxId: 1148]}
aqtinlqlegmrcaacassieraiakvpgvqscqvnfaleqavvsyhtpqiltdaverag
yharvlk

SCOPe Domain Coordinates for d2xmwa_:

Click to download the PDB-style file with coordinates for d2xmwa_.
(The format of our PDB-style files is described here.)

Timeline for d2xmwa_: