SCOPe 2.01: Domain d2xmwa_: 2xmw A:

Lineage for d2xmwa_ (2xmw A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families)

5. Family d.58.17.0: automated matches [191590] (1 protein)
   not a true family

6. Protein automated matches [191063] (2 species)
   not a true protein

7. Species Synechocystis sp. PCC 6803 [TaxId:1148] [189441] (1 PDB entry)

8. Domain d2xmwa_: 2xmw A: [170246]
   automated match to d1kqka_
   complexed with cu1

Details for d2xmwa_

PDB Entry: 2xmw, 1.8 Å

PDB Description: pacs, n-terminal domain, from synechocystis pcc6803

PDB Compounds: (A:) cation-transporting ATPase pacs

SCOPe Domain Sequences for d2xmwa_:

Sequence, based on SEQRES records:

>d2xmwa_ d.58.17.0 (A:) automated matches {Synechocystis sp. PCC 6803 [TaxId: 1148]}
aqtinlqlegmrcaacassieraiakvpgvqscqvnfaleqavvsyhgettpqiltdave
ragyharvlk

Sequence, based on observed residues (ATOM records):

>d2xmwa_ d.58.17.0 (A:) automated matches {Synechocystis sp. PCC 6803 [TaxId: 1148]}
aqtinlqlegmrcaacassieraiakvpgvqscqvnfaleqavvsyhtpqiltdaverag
yharvlk

Timeline for d2xmwa_:

• d2xmwa_ is new in SCOPe 2.01-stable
  
• d2xmwa_ appears in SCOPe 2.02
  
• d2xmwa_ appears in the current release, SCOPe 2.08