Lineage for d2xmvc_ (2xmv C:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1026488Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1029142Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) (S)
  5. 1029143Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 proteins)
  6. 1029233Protein automated matches [190409] (3 species)
    not a true protein
  7. 1029240Species Synechocystis sp. PCC 6803 [TaxId:1148] [189440] (2 PDB entries)
  8. 1029245Domain d2xmvc_: 2xmv C: [170242]
    automated match to d1sb6a_
    complexed with cu1; mutant

Details for d2xmvc_

PDB Entry: 2xmv (more details), 1.8 Å

PDB Description: Copper chaperone Atx1 from Synechocystis PCC6803 (Cu1, trimeric form, His61Tyr mutant)
PDB Compounds: (C:) ssr2857 protein

SCOPe Domain Sequences for d2xmvc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xmvc_ d.58.17.1 (C:) automated matches {Synechocystis sp. PCC 6803 [TaxId: 1148]}
tiqltvptiaceacaeavtkavqnedaqatvqvdltskkvtitsalgeeqlrtaiasagy
eve

SCOPe Domain Coordinates for d2xmvc_:

Click to download the PDB-style file with coordinates for d2xmvc_.
(The format of our PDB-style files is described here.)

Timeline for d2xmvc_: