Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) |
Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 proteins) |
Protein automated matches [190409] (4 species) not a true protein |
Species Synechocystis sp. PCC 6803 [TaxId:1148] [189440] (2 PDB entries) |
Domain d2xmva_: 2xmv A: [170240] automated match to d1sb6a_ complexed with cu1; mutant |
PDB Entry: 2xmv (more details), 1.8 Å
SCOPe Domain Sequences for d2xmva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xmva_ d.58.17.1 (A:) automated matches {Synechocystis sp. PCC 6803 [TaxId: 1148]} tiqltvptiaceacaeavtkavqnedaqatvqvdltskkvtitsalgeeqlrtaiasagy eve
Timeline for d2xmva_: