Lineage for d2xmva_ (2xmv A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2196856Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) (S)
  5. 2196857Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 proteins)
  6. 2196963Protein automated matches [190409] (4 species)
    not a true protein
  7. 2196976Species Synechocystis sp. PCC 6803 [TaxId:1148] [189440] (2 PDB entries)
  8. 2196979Domain d2xmva_: 2xmv A: [170240]
    automated match to d1sb6a_
    complexed with cu1; mutant

Details for d2xmva_

PDB Entry: 2xmv (more details), 1.8 Å

PDB Description: Copper chaperone Atx1 from Synechocystis PCC6803 (Cu1, trimeric form, His61Tyr mutant)
PDB Compounds: (A:) ssr2857 protein

SCOPe Domain Sequences for d2xmva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xmva_ d.58.17.1 (A:) automated matches {Synechocystis sp. PCC 6803 [TaxId: 1148]}
tiqltvptiaceacaeavtkavqnedaqatvqvdltskkvtitsalgeeqlrtaiasagy
eve

SCOPe Domain Coordinates for d2xmva_:

Click to download the PDB-style file with coordinates for d2xmva_.
(The format of our PDB-style files is described here.)

Timeline for d2xmva_: