SCOPe 2.08: Domain d2xmmb_: 2xmm B:

Lineage for d2xmmb_ (2xmm B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families)

5. Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 proteins)

6. Protein automated matches [190409] (5 species)
   not a true protein

7. Species Synechocystis sp. PCC 6803 [TaxId:1148] [189440] (2 PDB entries)

8. Domain d2xmmb_: 2xmm B: [170232]
   automated match to d1sb6a_
   complexed with cl, cu, na

Details for d2xmmb_

PDB Entry: 2xmm, 1.65 Å

PDB Description: visualising the metal-binding versatility of copper trafficking sites: h61y atx1 side-to-side

PDB Compounds: (B:) ssr2857 protein

SCOPe Domain Sequences for d2xmmb_:

Sequence; same for both SEQRES and ATOM records:

>d2xmmb_ d.58.17.1 (B:) automated matches {Synechocystis sp. PCC 6803 [TaxId: 1148]}
tiqltvptiaceacaeavtkavqnedaqatvqvdltskkvtitsalgeeqlrtaiasagy
eve

Timeline for d2xmmb_:

• d2xmmb_ first appeared in SCOPe 2.01
  
• d2xmmb_ appears in SCOPe 2.07